PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4NG275800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 228aa    MW: 25327.7 Da    PI: 4.8163
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4NG275800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF78.54.8e-25959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         k+ien   rqvtfskRr+g++KKA+EL vLCda+v v +fs++gkl+ey++
  Pavir.4NG275800.1.p  9 KKIENRVSRQVTFSKRRKGLIKKAHELAVLCDADVGVGVFSERGKLFEYPN 59
                         68***********************************************95 PP

2K-box54.84.2e-1986162984
                K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesL.slkeLqqLeqqLekslkkiRskKnellleqieelqkke 84 
                           ++ +++++  e+ +L++e+e+Lq  +  + GedL+sL s+ eL +LeqqLe +l k+R++K+ell++  +elq k 
  Pavir.4NG275800.1.p  86 HCTDHQQQMIAEIGRLRREYEQLQARLMAYTGEDLSSLtSVDELDELEQQLEAALCKVRARKEELLTSLNDELQLKV 162
                          6788899*******************************5689********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.4E-34160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.506161IPR002100Transcription factor, MADS-box
CDDcd002658.96E-36272No hitNo description
SuperFamilySSF554553.92E-28285IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-26323IPR002100Transcription factor, MADS-box
PfamPF003191.1E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-263859IPR002100Transcription factor, MADS-box
PfamPF014861.5E-1688161IPR002487Transcription factor, K-box
PROSITE profilePS5129711.86191197IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MGRGRVEMKK IENRVSRQVT FSKRRKGLIK KAHELAVLCD ADVGVGVFSE RGKLFEYPNP  60
PASLTDLIRR YEAVTNTQLL QVQETHCTDH QQQMIAEIGR LRREYEQLQA RLMAYTGEDL  120
SSLTSVDELD ELEQQLEAAL CKVRARKEEL LTSLNDELQL KVTVTAVGVE TEEIAEPLPP  180
PSPPFAYLLN VNEKSAASTV LQLWPQADDD DVGSGGGSGP PRGLQLW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-14181186Myocyte-specific enhancer factor 2B
1tqe_R1e-14181186Myocyte-specific enhancer factor 2B
1tqe_Q1e-14181186Myocyte-specific enhancer factor 2B
1tqe_P1e-14181186Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN5524825e-38FN552482.1 Pennisetum glaucum AFLP fragment RQVTKKA2-4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660548.12e-88PREDICTED: MADS-box transcription factor 30
SwissprotQ655V47e-53MAD30_ORYSJ; MADS-box transcription factor 30
TrEMBLK3XZ291e-99K3XZ29_SETIT; Uncharacterized protein
STRINGSi007187m3e-99(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP185037100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.21e-30MIKC_MADS family protein